PDB entry 4rcg

View 4rcg on RCSB PDB site
Description: Crystal Structure Analysis of MTB PEPCK without Mn+2
Class: lyase
Keywords: phosphoenolpyruvate carboxykinase, LYASE
Deposited on 2014-09-16, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: pckG, P425_00220, RVBD_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rcga1, d4rcga2
  • Heterogens: GDP, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rcgA (A:)
    mgsshhhhhhssglvprgshmtsatipgldtaptnhqgllswveevaeltqpdrvvftdg
    seeefqrlcdqlveagtfirlnpekhknsylalsdpsdvarvesrtyicsakeidagptn
    nwmdpgemrsimkdlyrgcmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmt
    rmgkaalekmgddgffvkalhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgy
    ggnallgkkcyslriasamahdegwlaehmlilklispenkayyfaaafpsacgktnlam
    lqptipgwraetlgddiawmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagn
    tvftnvaltddgdvwweglegdpqhlidwkgndwyfretetnaahpnsryctpmsqcpil
    apewddpqgvpisgilfggrrkttvplvteardwqhgvfigatlgseqtaaaegkvsnvr
    rdpmamlpflgynvgdyfqhwinlgkhadeaklpkvffvnwfrrgddgrflwpgfgensr
    vlkwivdriehkaggattpigtvpavedldldgldvdaadvaaalavdadewrqelplie
    ewlqfvgeklptgvkdefdalkerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rcgA (A:)
    gldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhk
    nsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyv
    vpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgapl
    epgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdegwla
    ehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgkdgr
    lyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpqhli
    dwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrkttvpl
    vteardwqhgvfigatlgseqtanvrrdpmamlpflgynvgdyfqhwinlgkhadeaklp
    kvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpavedldldgl
    dvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg