PDB entry 4rc9

View 4rc9 on RCSB PDB site
Description: Crystal Structure of the type II Dehydroquinate dehydratase from Acinetobacter baumannii at 2.03A Resolution
Class: lyase
Keywords: lyase
Deposited on 2014-09-15, released 2014-10-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9a_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9b_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9c_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9d_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9e_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9f_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9g_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9h_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9i_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9j_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9k_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii ATCC 17978 [TaxId:400667]
    Gene: A1S_2009, aroQ, F911_01683, HMPREF0010_00310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rc9l_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9A (A:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9B (B:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9C (C:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9D (D:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9E (E:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9F (F:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9G (G:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9H (H:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9I (I:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9J (J:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9K (K:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rc9L (L:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn