PDB entry 4rat

View 4rat on RCSB PDB site
Description: effects of temperature on protein structure and dynamics: x-ray crystallographic studies of the protein ribonuclease-a at nine different temperatures from 98 to 320 k
Deposited on 1991-08-13, released 1993-07-15
The last revision prior to the SCOP 1.61 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.149
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d4rat__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rat_ (-)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv