PDB entry 4rae

View 4rae on RCSB PDB site
Description: Crystal structure of Rv1600 encoded aminotransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: Histidinol phosphate aminotransferase, TRANSFERASE
Deposited on 2014-09-10, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4raea_
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4raeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4raeA (A:)
    mmtrsghpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvre
    aaidlhrypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrs
    aigfvpsysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsg
    qsvslpdlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafagg
    rlgyliatpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttsl
    ndmgfrvipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendafl
    rasariatdlvpvtrspvgapklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4raeA (A:)
    hpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidlh
    rypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfvp
    sysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvslp
    dlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgyli
    atpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgfr
    vipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasari
    atdlvpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4raeB (B:)
    mmtrsghpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvre
    aaidlhrypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrs
    aigfvpsysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsg
    qsvslpdlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafagg
    rlgyliatpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttsl
    ndmgfrvipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendafl
    rasariatdlvpvtrspvgapklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4raeB (B:)
    hpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidlh
    rypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfvp
    sysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvslp
    dlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgyli
    atpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgfr
    vipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasari
    atdlv