PDB entry 4ra8

View 4ra8 on RCSB PDB site
Description: Structure analysis of the Mip1a P8A mutant
Class: cytokine
Keywords: cytokine
Deposited on 2014-09-09, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (Start-68)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d4ra8a_
  • Chain 'B':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (0-68)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d4ra8b_
  • Chain 'C':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (Start-68)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d4ra8c_
  • Chain 'D':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (Start-68)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d4ra8d_
  • Chain 'E':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (Start-68)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d4ra8e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ra8A (A:)
    aslaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlels
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ra8A (A:)
    slaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ra8B (B:)
    aslaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ra8C (C:)
    aslaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlels
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ra8C (C:)
    aadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyv
    sdlels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ra8D (D:)
    aslaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlels
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ra8D (D:)
    adtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyvs
    dlels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ra8E (E:)
    aslaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlels
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ra8E (E:)
    slaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels