PDB entry 4ra5

View 4ra5 on RCSB PDB site
Description: Human Protein Kinase C THETA IN COMPLEX WITH LIGAND COMPOUND 11a (6-[(1,3-Dimethyl-azetidin-3-yl)-methyl-amino]-4(R)-methyl-7-phenyl-2,10-dihydro-9-oxa-1,2,4a-triaza-phenanthren-3-one)
Class: Transferase/transferase inhibitor
Keywords: PKC THETA KINASE, kinase domain, PROTEROS BIOSTRUCTURES GMBH, Transferase-transferase inhibitor complex
Deposited on 2014-09-09, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human protein kinase c theta
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCQ, PRKCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04759 (0-332)
      • engineered mutation (7)
      • engineered mutation (164)
      • expression tag (333)
    Domains in SCOPe 2.04: d4ra5a_
  • Chain 'B':
    Compound: human protein kinase c theta
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCQ, PRKCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04759
      • engineered mutation (7)
      • engineered mutation (164)
  • Heterogens: 3L0, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ra5A (A:)
    klkiedfelhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvls
    lawehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglq
    flhskgivyrdlkldnilldkdghikiadfgmckenmlgdaktnefcgtpdyiapeillg
    qkynhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvkl
    fvrepekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdcsnfdkeflnekp
    rlsfadralinsmdqnmfrnfsfmnpgmerlish
    

  • Chain 'B':
    No sequence available.