PDB entry 4ra4

View 4ra4 on RCSB PDB site
Description: Crystal Structure of Human Protein Kinase C Alpha in Complex with Compound 28 ((R)-6-((3S,4S)-1,3-Dimethyl-piperidin-4-yl)-7-(2-fluoro-phenyl)-4-methyl-2,10-dihydro-9-oxa-1,2,4a-triaza-phenanthren-3-one)
Class: Transferase/transferase inhibitor
Keywords: Kinase domain, Transferase-transferase inhibitor complex
Deposited on 2014-09-09, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.19
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7RSM7
      • see remark 999 (250)
    Domains in SCOPe 2.04: d4ra4a_
  • Heterogens: 3KZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ra4A (A:)
    ispsedrkqpsnnldrvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviq
    dddvectmvekrvlalldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfke
    pqavfyaaeisiglfflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttrt
    fcgtpdyiapeiiayqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsy
    pkslskeavsickglmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpk
    vsgkgaenfdkfftrgqpvltppdqlvianidqsdfegfsyvnpqfvhpilqsav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ra4A (A:)
    drvkltdfnflmvlgkgsfgkvmladrkgteelyaikilkkdvviqdddvectmvekrvl
    alldkppfltqlhscfqtvdrlyfvmeyvnggdlmyhiqqvgkfkepqavfyaaeisigl
    fflhkrgiiyrdlkldnvmldseghikiadfgmckehmmdgvttrtfcgtpdyiapeiia
    yqpygksvdwwaygvllyemlagqppfdgededelfqsimehnvsypkslskeavsickg
    lmtkhpakrlgcgpegerdvrehaffrridweklenreiqppfkpkgqpvltppdqlvia
    nidqsdfegfsyvnpqfvhp