PDB entry 4r9w

View 4r9w on RCSB PDB site
Description: Crystal structure of platelet factor 4 complexed with fondaparinux
Class: cytokine
Keywords: PF4, fondaparinux, CXC chemokine, platelet factor, glycosaminoglycan, platelet, CYTOKINE
Deposited on 2014-09-08, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet factor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PF4, CXCL4, SCYB4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r9wa_
  • Chain 'B':
    Compound: platelet factor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PF4, CXCL4, SCYB4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r9wb_
  • Heterogens: NTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r9wA (A:)
    eaeedgdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaply
    kkiikklles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r9wA (A:)
    lqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykkiikkl
    le
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r9wB (B:)
    eaeedgdlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaply
    kkiikklles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r9wB (B:)
    dlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykkiikk
    lles