PDB entry 4r9r

View 4r9r on RCSB PDB site
Description: Mycobacterium tuberculosis InhA bound to NITD-564
Class: oxidoreductase
Keywords: enoyl-acyl carrier protein reductase, OXIDOREDUCTASE
Deposited on 2014-09-07, released 2015-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: P425_01541, RVBD_1484
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r9ra_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: P425_01541, RVBD_1484
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r9rc_
  • Chain 'E':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: P425_01541, RVBD_1484
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r9re_
  • Chain 'G':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: P425_01541, RVBD_1484
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r9rg_
  • Heterogens: NAD, 3KX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r9rA (A:)
    gshmtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpak
    aplleldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvs
    kgihisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvar
    eagkygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatp
    vaktvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r9rA (A:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
    callsdwlpattgdiiyadggahtqll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r9rC (C:)
    gshmtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpak
    aplleldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvs
    kgihisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvar
    eagkygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatp
    vaktvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r9rC (C:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
    callsdwlpattgdiiyadggahtqll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4r9rE (E:)
    gshmtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpak
    aplleldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvs
    kgihisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvar
    eagkygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatp
    vaktvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r9rE (E:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
    callsdwlpattgdiiyadggahtqll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4r9rG (G:)
    gshmtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpak
    aplleldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvs
    kgihisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvar
    eagkygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatp
    vaktvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r9rG (G:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
    callsdwlpattgdiiyadggahtqll