PDB entry 4r8h

View 4r8h on RCSB PDB site
Description: The role of protein-ligand contacts in allosteric regulation of the Escherichia coli Catabolite Activator Protein
Class: Transcription
Keywords: Transcription factor, Transcription
Deposited on 2014-09-02, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-activated global transcriptional regulator CRP
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r8ha1, d4r8ha2
  • Chain 'B':
    Compound: cAMP-activated global transcriptional regulator CRP
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r8hb1, d4r8hb2
  • Heterogens: SP1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r8hA (A:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8hA (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r8hB (B:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8hB (B:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvygt