PDB entry 4r8d

View 4r8d on RCSB PDB site
Description: Crystal structure of Rv1600 encoded aminotransferase in complex with PLP-MES from Mycobacterium tuberculosis
Class: transferase
Keywords: Histidinol phosphate Aminotransferase, TRANSFERASE
Deposited on 2014-09-01, released 2015-09-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: hisC, P425_01659, RVBD_1600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4r8da_
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: hisC, P425_01659, RVBD_1600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4r8db_
  • Heterogens: PLP, MES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r8dA (A:)
    mmtrsghpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvre
    aaidlhrypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrs
    aigfvpsysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsg
    qsvslpdlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafagg
    rlgyliatpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttsl
    ndmgfrvipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendafl
    rasariatdlvpvtrspvgapklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8dA (A:)
    ghpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidl
    hrypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfv
    psysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvsl
    pdlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgyl
    iatpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgf
    rvipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasar
    iatdlvpvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r8dB (B:)
    mmtrsghpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvre
    aaidlhrypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrs
    aigfvpsysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsg
    qsvslpdlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafagg
    rlgyliatpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttsl
    ndmgfrvipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendafl
    rasariatdlvpvtrspvgapklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8dB (B:)
    pvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidlhr
    ypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfvps
    ysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvslpd
    lcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgylia
    tpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgfrv
    ipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasaria
    tdlvp