PDB entry 4r7d

View 4r7d on RCSB PDB site
Description: Fab Hu 15C1
Class: immune system
Keywords: TLR4 antibody, IMMUNE SYSTEM
Deposited on 2014-08-27, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
  • Chain 'B':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
    Domains in SCOPe 2.07: d4r7db1, d4r7db2
  • Chain 'C':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
  • Chain 'D':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D
    Domains in SCOPe 2.07: d4r7dd1, d4r7dd2
  • Chain 'E':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D
  • Chain 'F':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D
    Domains in SCOPe 2.07: d4r7df1, d4r7df2
  • Chain 'G':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
  • Chain 'H':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
    Domains in SCOPe 2.07: d4r7dh1, d4r7dh2
  • Chain 'I':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
  • Chain 'J':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
    Domains in SCOPe 2.07: d4r7dj1, d4r7dj2
  • Chain 'K':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
  • Chain 'L':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
    Domains in SCOPe 2.07: d4r7dl1, d4r7dl2
  • Chain 'M':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D (0-End)
  • Chain 'N':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D
    Domains in SCOPe 2.07: d4r7dn1, d4r7dn2
  • Chain 'O':
    Compound: Fab Hu 15C1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D
  • Chain 'P':
    Compound: Fab Hu 15C1 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R7D
    Domains in SCOPe 2.07: d4r7dp1, d4r7dp2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r7dB (B:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dB (B:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r7dD (D:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dD (D:)
    ivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvpsr
    fsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4r7dF (F:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dF (F:)
    ivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvpsr
    fsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4r7dH (H:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dH (H:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4r7dJ (J:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dJ (J:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4r7dL (L:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dL (L:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4r7dN (N:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dN (N:)
    ivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvpsr
    fsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4r7dP (P:)
    eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
    rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r7dP (P:)
    ivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvpsr
    fsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg