PDB entry 4r6s

View 4r6s on RCSB PDB site
Description: Crystal structure of PPARgammma in complex with SR1663
Class: transcription
Keywords: nuclear receptor ligand binding domain, TRANSCRIPTION
Deposited on 2014-08-26, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (0-End)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d4r6sa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231
      • engineered mutation (244)
    Domains in SCOPe 2.07: d4r6sb_
  • Heterogens: 3K2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r6sA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivfehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6sA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivfehvqllq
    vikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r6sB (B:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivfehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6sB (B:)
    esadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkikfkhike
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivfehvqllqvi
    kktethpllqeiyk