PDB entry 4r6d

View 4r6d on RCSB PDB site
Description: Modified mTFP* for enhanced metal binding: co-crystallization with CuCl2
Class: fluorescent protein
Keywords: beta barrel topology, fluorescent protein, engineered metalloenzyme, Diels-Alderase
Deposited on 2014-08-25, released 2014-11-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.153
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein cFP484
    Species: Clavularia sp. [TaxId:86521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y3 (1-213)
      • engineered mutation (20)
      • engineered mutation (37)
      • engineered mutation (39)
      • engineered mutation (57-58)
      • chromophore (61)
      • engineered mutation (65)
      • engineered mutation (73-74)
      • engineered mutation (106)
      • engineered mutation (116-118)
      • engineered mutation (120)
      • engineered mutation (134-135)
      • engineered mutation (137-138)
      • engineered mutation (142)
      • engineered mutation (151)
      • engineered mutation (154-155)
      • engineered mutation (157)
      • engineered mutation (165)
      • engineered mutation (168)
      • engineered mutation (172)
      • engineered mutation (175)
      • engineered mutation (179)
      • engineered mutation (194)
      • engineered mutation (201)
      • engineered mutation (206)
      • engineered mutation (209)
      • expression tag (214)
    Domains in SCOPe 2.06: d4r6da1, d4r6da2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r6dA (A:)
    sgvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydiltta
    fxnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkg
    enfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakka
    vklpdyhfvdhrieclnhdkdhnkvtvyesavarn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6dA (A:)
    gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
    xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
    nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
    klpdyhfvdhrieclnhdkdhnkvtvyesavarn