PDB entry 4r6b

View 4r6b on RCSB PDB site
Description: Rational Design of Enhanced Photoresistance in a Photoswitchable Fluorescent Protein
Class: Fluorescent protein
Keywords: Beta-barrel, Fluorescent protein
Deposited on 2014-08-23, released 2015-02-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (164)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4r6ba_
  • Chain 'B':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • chromophore (69)
      • engineered mutation (164)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4r6bb_
  • Chain 'C':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • expression tag (4-5)
      • chromophore (69)
      • engineered mutation (164)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4r6bc_
  • Chain 'D':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (164)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4r6bd_
  • Heterogens: SO4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r6bA (A:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6bA (A:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r6bB (B:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6bB (B:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsrttykake
    kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r6bC (C:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6bC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r6bD (D:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r6bD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditaalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn