PDB entry 4r5z

View 4r5z on RCSB PDB site
Description: Crystal structure of Rv3772 encoded aminotransferase
Class: Transferase
Keywords: Aminotransferase, Transferase
Deposited on 2014-08-22, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phenylalanine aminotransferase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: pat, P425_03929, RVBD_3772
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6Y4H4 (2-353)
      • expression tag (1)
    Domains in SCOPe 2.07: d4r5za1, d4r5za2
  • Chain 'B':
    Compound: Putative phenylalanine aminotransferase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: pat, P425_03929, RVBD_3772
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6Y4H4 (2-353)
      • expression tag (1)
    Domains in SCOPe 2.07: d4r5zb1, d4r5zb2
  • Chain 'C':
    Compound: Putative phenylalanine aminotransferase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: pat, P425_03929, RVBD_3772
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6Y4H4 (2-353)
      • expression tag (1)
    Domains in SCOPe 2.07: d4r5zc1, d4r5zc2
  • Chain 'D':
    Compound: Putative phenylalanine aminotransferase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: pat, P425_03929, RVBD_3772
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6Y4H4 (2-353)
      • expression tag (1)
    Domains in SCOPe 2.07: d4r5zd1, d4r5zd2
  • Heterogens: SIN, PMP, GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r5zA (A:)
    mvtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngc
    vqlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrv
    agaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahi
    liaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvital
    dkvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfv
    wlplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdqklaaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5zA (A:)
    vtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcv
    qlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrva
    gaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahil
    iaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitald
    kvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvw
    lplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r5zB (B:)
    mvtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngc
    vqlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrv
    agaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahi
    liaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvital
    dkvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfv
    wlplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdqklaaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5zB (B:)
    vtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcv
    qlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrva
    gaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahil
    iaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitald
    kvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvw
    lplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r5zC (C:)
    mvtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngc
    vqlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrv
    agaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahi
    liaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvital
    dkvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfv
    wlplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdqklaaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5zC (C:)
    vtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcv
    qlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrva
    gaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahil
    iaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitald
    kvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvw
    lplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r5zD (D:)
    mvtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngc
    vqlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrv
    agaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahi
    liaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvital
    dkvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfv
    wlplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdqklaaal
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5zD (D:)
    vtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcv
    qlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrva
    gaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahil
    iaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitald
    kvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvw
    lplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq