PDB entry 4r5s

View 4r5s on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 L858R in complex with FIIN-3
Class: transferase
Keywords: EGFR, L858R, Kinase, FIIN-3, TRANSFERASE
Deposited on 2014-08-22, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (166)
    Domains in SCOPe 2.07: d4r5sa_
  • Heterogens: FI3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r5sA (A:)
    gspsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5sA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeevpikwmales
    ilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvym
    imvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpedmddvvdadeyli