PDB entry 4r5l

View 4r5l on RCSB PDB site
Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-C)
Class: Chaperone
Keywords: Helical bundle, beta sheets, Chaperone, membrane
Deposited on 2014-08-21, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.207
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: dnaK, groP, grpF, seg, b0014, JW0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (11-End)
      • expression tag (3-10)
    Domains in SCOPe 2.07: d4r5la1, d4r5la2, d4r5la3
  • Chain 'B':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: dnaK, groP, grpF, seg, b0014, JW0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (11-End)
      • expression tag (0-10)
    Domains in SCOPe 2.07: d4r5lb1, d4r5lb2, d4r5lb3
  • Chain 'C':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: dnaK, groP, grpF, seg, b0014, JW0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (11-End)
      • expression tag (3-10)
    Domains in SCOPe 2.07: d4r5lc1, d4r5lc2, d4r5lc3
  • Chain 'D':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: dnaK, groP, grpF, seg, b0014, JW0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (11-End)
      • expression tag (2-10)
    Domains in SCOPe 2.07: d4r5ld1, d4r5ld2, d4r5ld3
  • Heterogens: SO4, PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r5lA (A:)
    mhhhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavt
    ihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeq
    kitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdkl
    paddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5lA (A:)
    hhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
    lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
    ikalnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddkt
    aiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r5lB (B:)
    mhhhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavt
    ihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeq
    kitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdkl
    paddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5lB (B:)
    mhhhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavt
    ihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeq
    kitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdkl
    paddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r5lC (C:)
    mhhhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavt
    ihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeq
    kitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdkl
    paddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5lC (C:)
    hhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
    lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
    ikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpad
    dktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r5lD (D:)
    mhhhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavt
    ihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeq
    kitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdkl
    paddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5lD (D:)
    hhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtih
    vlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqki
    tikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpa
    ddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqh