PDB entry 4r5k

View 4r5k on RCSB PDB site
Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-B)
Class: Chaperone
Keywords: Helical bundle, beta sheets, Chaperone, membrane
Deposited on 2014-08-21, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: dnaK, groP, grpF, seg, b0014, JW0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (9-End)
      • expression tag (1-8)
    Domains in SCOPe 2.08: d4r5ka1, d4r5ka2, d4r5ka3
  • Chain 'B':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: dnaK, groP, grpF, seg, b0014, JW0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (9-227)
      • expression tag (1-8)
    Domains in SCOPe 2.08: d4r5kb1, d4r5kb2, d4r5kb3
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r5kA (A:)
    mhhhhhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtih
    vlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqki
    tikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpa
    ddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5kA (A:)
    hhhhhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
    lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
    ikanedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddkta
    iesaltaletalkgedkaaieakmqelaqvsqklmeiaqqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r5kB (B:)
    mhhhhhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtih
    vlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqki
    tikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpa
    ddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5kB (B:)
    hhhhhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
    lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
    ikanedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddkta
    iesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqha