PDB entry 4r5h

View 4r5h on RCSB PDB site
Description: Crystal structure of sp-Aspartate-Semialdehyde-Dehydrogenase with Nicotinamide-Adenine-Dinucleotide-Phosphate and 3-carboxy-propenyl-phthalic acid
Class: oxidoreductase
Keywords: Rossmann Fold, Oxidoreductase, NADP
Deposited on 2014-08-21, released 2014-12-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:406563]
    Gene: asd, CGSSp23BS72_03388
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5MTN0 (Start-357)
      • expression tag (358-359)
    Domains in SCOPe 2.04: d4r5ha1, d4r5ha2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:406563]
    Gene: asd, CGSSp23BS72_03388
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4r5hb1, d4r5hb2
  • Heterogens: EDO, NA, 3JN, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r5hA (A:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5hA (A:)
    gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
    fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
    iiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvk
    pcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsa
    tcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrd
    tfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r5hB (B:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5hB (B:)
    gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
    fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
    iiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvk
    pcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsa
    tcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrd
    tfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelk