PDB entry 4r5f

View 4r5f on RCSB PDB site
Description: X-ray structure of the D199K mutant of the cysteine desulfurase IscS from A. fulgidus
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2014-08-21, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase IscS 2
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Gene: iscS2, AF_0564
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29689
      • conflict (15)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d4r5fa_
  • Heterogens: CA, CL, PMP, PG4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r5fA (A:)
    mayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvnggg
    gtvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipv
    gkygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgq
    ievdvekigadmltissnkiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsi
    vgfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyie
    gesivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvd
    rllevlpgvierlrsmsplyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r5fA (A:)
    ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
    tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
    kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
    evdvekigadmltissnkiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
    gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
    esivlsldmagiqastgqpshvlmacglkheeahgtllltlgryntdedvdrllevlpgv
    ierlrsmsp