PDB entry 4r52

View 4r52 on RCSB PDB site
Description: 1.5 angstrom crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Cupriavidus metallidurans
Class: oxidoreductase
Keywords: Cupin Rubredoxin, OXIDOREDUCTASE
Deposited on 2014-08-20, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-hydroxyanthranilate 3,4-dioxygenase
  Species: Cupriavidus metallidurans CH34 [TaxId:266264]
  Gene: nbaC, nbaC Rmet_5193, Rmet_5193
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1LCS4 (0-173)
  Domains in SCOPe 2.07: d4r52a_
• Heterogens: FE2, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4r52A (A:)
  mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
  qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
  fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa