PDB entry 4r4y

View 4r4y on RCSB PDB site
Description: Structural basis of a point mutation that causes the genetic disease Aspartylglucosaminuria
Class: hydrolase
Keywords: AGU structure, autoprocessing,glycosylasparaginase, lysosomal storage disease, pre-autoproteolysis trap, Hydrolase
Deposited on 2014-08-20, released 2014-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase
    Species: Elizabethkingia miricola [TaxId:172045]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47898 (Start-294)
      • engineered mutation (171)
    Domains in SCOPe 2.08: d4r4ya_
  • Chain 'B':
    Compound: N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase
    Species: Elizabethkingia miricola [TaxId:172045]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47898 (0-294)
      • engineered mutation (171)
    Domains in SCOPe 2.08: d4r4yb_
  • Heterogens: SD4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r4yA (A:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhdtigmialdaqgnlsgacttsdmaykmhgr
    vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
    kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r4yA (A:)
    nkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdgr
    vtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkken
    lltaesekewkewlktsqykpivnienhdtigmialdaqgnlsgacttsdmaykmhgrvg
    dspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaverivki
    vnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r4yB (B:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhdtigmialdaqgnlsgacttsdmaykmhgr
    vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
    kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r4yB (B:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlvedrpdrdgrvtldacimd
    enynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkkenlltaeseke
    wkewlkttigmialdaqgnlsgacttsdmaykmhgrvgdspiigaglfvdneigaatatg
    hgeevirtvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkg
    eygayciqdgfnfavhdqkgnrletpgfalk