PDB entry 4r43

View 4r43 on RCSB PDB site
Description: Crystal Structure Analysis of MTB PEPCK
Class: lyase
Keywords: kinase, GDP Binding, LYASE
Deposited on 2014-08-19, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: BCGT_4014, P425_00220, pckG, RVBD_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r43a1, d4r43a2
  • Heterogens: GDP, MN, PEG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r43A (A:)
    mgsshhhhhhssglvprgshmtsatipgldtaptnhqgllswveevaeltqpdrvvftdg
    seeefqrlcdqlveagtfirlnpekhknsylalsdpsdvarvesrtyicsakeidagptn
    nwmdpgemrsimkdlyrgcmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmt
    rmgkaalekmgddgffvkalhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgy
    ggnallgkkcyslriasamahdegwlaehmlilklispenkayyfaaafpsacgktnlam
    lqptipgwraetlgddiawmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagn
    tvftnvaltddgdvwweglegdpqhlidwkgndwyfretetnaahpnsryctpmsqcpil
    apewddpqgvpisgilfggrrkttvplvteardwqhgvfigatlgseqtaaaegkvgnvr
    rdpmamlpflgynvgdyfqhwinlgkhadesklpkvffvnwfrrgddgrflwpgfgensr
    vlkwivdriehkaggattpigtvpavedldldgldvdaadvaaalavdadewrqelplie
    ewlqfvgeklptgvkdefdalkerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r43A (A:)
    ipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpek
    hknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtm
    yvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvga
    plepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdegw
    laehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgkd
    grlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpqh
    lidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrkttv
    plvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinlg
    khadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpa
    vedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerl
    g