PDB entry 4r40

View 4r40 on RCSB PDB site
Description: Crystal Structure of TolB/Pal complex from Yersinia pestis.
Class: protein transport
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta fold and beta propeller fold, translocation and peptidoglycan-associated outer membrane lipoprotein, PROTEIN TRANSPORT
Deposited on 2014-08-18, released 2014-09-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.173
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tolb
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: tolB, y3055, YPO1124, YP_1032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4r40a1, d4r40a2
  • Chain 'B':
    Compound: peptidoglycan-associated lipoprotein
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: excC, pal, y3054, YPO1125, YP_1031
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4r40b_
  • Chain 'C':
    Compound: protein tolb
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: tolB, y3055, YPO1124, YP_1032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4r40c1, d4r40c2
  • Chain 'D':
    Compound: peptidoglycan-associated lipoprotein
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: excC, pal, y3054, YPO1125, YP_1031
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4r40d_
  • Heterogens: SO4, FMT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r40A (A:)
    snavrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqq
    pstaaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkq
    wlrysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrsp
    eplmspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtkla
    falsksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvni
    nggvpqritwegsqnqnadvspdgkflvlvssnggaqhiakqdletgavqvltdtlldet
    psiapngtmviysstqglgsvlqlvstdgrfkarlpatdgqvkfpawspyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r40A (A:)
    vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
    aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
    ysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrspepl
    mspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtklafal
    sksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvningg
    vpqritwegsqnqnadvspdgkflvlvssnggaqhiakqdletgavqvltdtlldetpsi
    apngtmviysstqglgsvlqlvstdgrfkarlpdgqvkfpawspyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r40B (B:)
    snadqsgmgagtgtengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldaha
    aflrsnpsdkvvveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkek
    pavlghdeaafaknrravlvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r40B (B:)
    snlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkvvvegha
    dergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaafaknrra
    vlvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r40C (C:)
    snavrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqq
    pstaaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkq
    wlrysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrsp
    eplmspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtkla
    falsksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvni
    nggvpqritwegsqnqnadvspdgkflvlvssnggaqhiakqdletgavqvltdtlldet
    psiapngtmviysstqglgsvlqlvstdgrfkarlpatdgqvkfpawspyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r40C (C:)
    vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
    aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
    ysahtvsdevfekltgikgafrtriayvvktnggkfphelrvsdydgynqfvvhrspepl
    mspawspdgskiayvtfesgksalviqtlangairqvasfprhngapafspdgtklafal
    sksgslnlyvmdlasgqisqvtdgrsnntepswfpdsqnlaytsdqggrpqvykvningg
    vpqritwegsqnqnadvspdgkflvlvssnggaqhiakqdletgavqvltdtlldetpsi
    apngtmviysstqglgsvlqlvstdgrfkarlpagqvkfpawspy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r40D (D:)
    snadqsgmgagtgtengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldaha
    aflrsnpsdkvvveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkek
    pavlghdeaafaknrravlvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r40D (D:)
    snlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkvvvegha
    dergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaafaknrra
    vlvy