PDB entry 4r3w

View 4r3w on RCSB PDB site
Description: Crystal Structure Analysis of the 1,2,3-tricarboxylate benzoic acid bound to sp-ASADH-2'5'-ADP complex
Class: oxidoreductase
Keywords: Dehydrogenase, Nicotineamid-dinucleotide, OXIDOREDUCTASE
Deposited on 2014-08-18, released 2014-12-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:406563]
    Gene: asd, CGSSp23BS72_03388
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r3wa1, d4r3wa2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:406563]
    Gene: asd, CGSSp23BS72_03388
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r3wb1, d4r3wb2
  • Heterogens: NA, 3GQ, EDO, ACT, A2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r3wA (A:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r3wA (A:)
    gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
    fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
    iiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvk
    pcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsa
    tcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrd
    tfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r3wB (B:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r3wB (B:)
    gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
    fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
    iiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvk
    pcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsa
    tcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrd
    tfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvr