PDB entry 4r36

View 4r36 on RCSB PDB site
Description: Crystal structure analysis of LpxA, a UDP-N-acetylglucosamine acyltransferase from Bacteroides fragilis 9343
Class: transferase
Keywords: left-handed beta helix, UDP-N-acetylglucosamine acyltransferase, Transferase
Deposited on 2014-08-14, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: lpxA, BF9343_0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r36a_
  • Chain 'B':
    Compound: Putative acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: lpxA, BF9343_0789
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r36b_
  • Heterogens: PG0, ACT, CA, PE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r36A (A:)
    mgsshhhhhhssglvprgshmisplayihpeakigenveiapfvyidrnvvigdnnkima
    nanilygsrigngntifpgavigaipqdlkfkgeestaeigdnnlirenvtinrgtaakg
    rtivgnnnllmegvhvahdaligngcivgnstkmageiiiddnaiisanvlmhqfcrvgg
    yvmiqggcrfskdippyiiagrepiaysginiiglrrrgfsneiienihnayriiyqsgl
    ntsdaltkveaevpaspeieyivdfirnsergiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r36A (A:)
    misplayihpeakigenveiapfvyidrnvvigdnnkimananilygsrigngntifpga
    vigaipqdlkfkgeestaeigdnnlirenvtinrgtaakgrtivgnnnllmegvhvahda
    ligngcivgnstkmageiiiddnaiisanvlmhqfcrvggyvmiqggcrfskdippyiia
    grepiaysginiiglrrrgfsneiienihnayriiyqsglntsdaltkveaevpaspeie
    yivdfirnsergiir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r36B (B:)
    mgsshhhhhhssglvprgshmisplayihpeakigenveiapfvyidrnvvigdnnkima
    nanilygsrigngntifpgavigaipqdlkfkgeestaeigdnnlirenvtinrgtaakg
    rtivgnnnllmegvhvahdaligngcivgnstkmageiiiddnaiisanvlmhqfcrvgg
    yvmiqggcrfskdippyiiagrepiaysginiiglrrrgfsneiienihnayriiyqsgl
    ntsdaltkveaevpaspeieyivdfirnsergiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r36B (B:)
    misplayihpeakigenveiapfvyidrnvvigdnnkimananilygsrigngntifpga
    vigaipqdlkfkgeestaeigdnnlirenvtinrgtaakgrtivgnnnllmegvhvahda
    ligngcivgnstkmageiiiddnaiisanvlmhqfcrvggyvmiqggcrfskdippyiia
    grepiaysginiiglrrrgfsneiienihnayriiyqsglntsdaltkveaevpaspeie
    yivdfirnsergiir