PDB entry 4r2u

View 4r2u on RCSB PDB site
Description: Crystal Structure of PPARgamma in complex with SR1664
Class: transcription
Keywords: nuclear receptor ligand binding domain, TRANSCRIPTION
Deposited on 2014-08-13, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r2ua_
  • Chain 'D':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r2ud_
  • Heterogens: 3JX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r2uA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r2uA (A:)
    npesadlralakhlydsyiksfpltkakarailtgtdkspfviydmnslmmgedkikske
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetdmslhpllqeiykdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r2uD (D:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r2uD (D:)
    sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkhi
    tkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktehpllqeiykd