PDB entry 4r1y

View 4r1y on RCSB PDB site
Description: Identification and optimization of pyridazinones as potent and selective c-Met kinase inhibitor
Class: transferase/transferase inhibitor
Keywords: Transferase inhibitor, Transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-08-08, released 2015-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1ya_
  • Heterogens: 3EH, 7PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r1yA (A:)
    lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
    nptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkey
    ysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditv
    yllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1yA (A:)
    lvqavqhvvigpsslivhfnevigrghfgcvyhgtllihcavkslnsqfltegiimkdfs
    hpnvlsllgiclsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskk
    fvhrdlaarncmldekftvkvadfglardmydkeyysvhtgaklpvkwmaleslqtqkft
    tksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwh
    pkaemrpsfselvsrisaifstfig