PDB entry 4r1p

View 4r1p on RCSB PDB site
Description: Crystal Structure of Thermophilic Geobacillus kaustophilus L-Arabinose isomerase with Mn2+
Class: Isomerase
Keywords: Hexamer, Themophile, Thermostable, AI fold, Isomerase
Deposited on 2014-08-07, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1pa1, d4r1pa2
  • Chain 'B':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1pb1, d4r1pb2
  • Chain 'C':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1pc1, d4r1pc2
  • Chain 'D':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1pd1, d4r1pd2
  • Chain 'E':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1pe1, d4r1pe2
  • Chain 'F':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1pf1, d4r1pf2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r1pA (A:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1pA (A:)
    lslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeir
    rvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfm
    nlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarf
    gdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivp
    agrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegy
    gfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatrp
    rvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklpv
    arilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvss
    fknelkwnevfwrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r1pB (B:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1pB (B:)
    lslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeir
    rvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfm
    nlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarf
    gdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivp
    agrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegy
    gfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatrp
    rvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklpv
    arilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvss
    fknelkwnevfw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r1pC (C:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1pC (C:)
    mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
    rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
    mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
    fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
    pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
    ygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatr
    prvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklp
    varilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvs
    sfknelkwnevfwrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r1pD (D:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1pD (D:)
    lslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeir
    rvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfm
    nlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarf
    gdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivp
    agrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegy
    gfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatrp
    rvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklpv
    arilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvss
    fknelkwnevfwrg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4r1pE (E:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1pE (E:)
    mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
    rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
    mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
    fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
    pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
    ygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatr
    prvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklp
    varilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvs
    sfknelkwnevfwrg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4r1pF (F:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1pF (F:)
    lrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeirrv
    cleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfmnl
    nqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarfgd
    nmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivpag
    rqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegygf
    ggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatrprv
    evhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklpvar
    ilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvssfk
    nelkwnevfwrg