PDB entry 4r1o

View 4r1o on RCSB PDB site
Description: Crystal Structure of Thermophilic Geobacillus kaustophilus L-Arabinose isomerase
Class: isomerase
Keywords: Hexamer, Thermophile, thermostable, AI fold, Isomerase
Deposited on 2014-08-07, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1oa1, d4r1oa2
  • Chain 'B':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1ob1, d4r1ob2
  • Chain 'C':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1oc1, d4r1oc2
  • Chain 'D':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1od1, d4r1od2
  • Chain 'E':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1oe1, d4r1oe2
  • Chain 'F':
    Compound: L-arabinose isomerase
    Species: GEOBACILLUS KAUSTOPHILUS HTA426 [TaxId:235909]
    Gene: araA, GK1904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1of1, d4r1of2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r1oA (A:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1oA (A:)
    mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
    rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
    mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
    fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
    pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
    ygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatr
    prvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklp
    varilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvs
    sfknelkwnevfwrgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r1oB (B:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1oB (B:)
    mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
    rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
    mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
    fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
    pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
    ygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatr
    prvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklp
    varilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvs
    sfknelkwnevfwrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r1oC (C:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1oC (C:)
    mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
    rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
    mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
    fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
    pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
    ygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatr
    prvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklp
    varilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvs
    sfknelkwnevfwrgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4r1oD (D:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1oD (D:)
    mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
    rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
    mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
    fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
    pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
    ygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatr
    prvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklp
    varilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvs
    sfknelkwnevfwrgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4r1oE (E:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1oE (E:)
    lslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeir
    rvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfm
    nlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarf
    gdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivp
    agrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegy
    gfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatrp
    rvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklpv
    arilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvss
    fknelkwnevfwrg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4r1oF (F:)
    mmlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpee
    irrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmd
    fmnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkva
    rfgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydi
    vpagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmae
    gygfggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaat
    rprvevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpkl
    pvarilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsv
    ssfknelkwnevfwrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r1oF (F:)
    slrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeirr
    vcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfmn
    lnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarfg
    dnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivpa
    grqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegyg
    fggegdwktaalvrlmkvmadgkgtsfmedytyhfepgnelilgahmlevcptiaatrpr
    vevhplsiggkedparlvfdggegaavnaslidlghrfrlivnevdavkpehdmpklpva
    rilwkprpslrdsaeawilaggahhtcfsfavtteqlqdfaemagiecvvinehtsvssf
    knelkwnevfwrg