PDB entry 4r1n

View 4r1n on RCSB PDB site
Description: Crystal structure of (S)-3-hydroxybutylryl-CoA dehydrogenase form the n-butanol sysnthesizing bacterium, Clostridium butyricum.
Class: oxidoreductase
Keywords: NAD-binding Rossmann-fold domains, OXIDOREDUCTASE
Deposited on 2014-08-07, released 2015-07-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum E4 str. BoNT E BL5262 [TaxId:632245]
    Gene: CLP_3850, hbd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1na1, d4r1na2
  • Chain 'B':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum E4 str. BoNT E BL5262 [TaxId:632245]
    Gene: CLP_3850, hbd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1nb1, d4r1nb2
  • Chain 'C':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum E4 str. BoNT E BL5262 [TaxId:632245]
    Gene: CLP_3850, hbd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1nc1, d4r1nc2
  • Chain 'D':
    Compound: 3-hydroxybutyryl-CoA dehydrogenase
    Species: Clostridium butyricum E4 str. BoNT E BL5262 [TaxId:632245]
    Gene: CLP_3850, hbd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r1nd1, d4r1nd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4r1nA (A:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydysk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4r1nB (B:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydysk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4r1nC (C:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydysk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4r1nD (D:)
    mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
    dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
    itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
    eapgfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvcla
    imdvlynetgdtkyrassllrkyvragwlgrktgkgfydysk