PDB entry 4qzi

View 4qzi on RCSB PDB site
Description: Mouse Tdt, F401A mutant, in complex with a DSB substrate and Zn2+
Class: transferase/DNA
Keywords: Terminal deoxynucleotidyltransferase, nucleus, TRANSFERASE-DNA complex
Deposited on 2014-07-27, released 2015-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotidylexotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: DNTT, TDT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09838 (Start-371)
      • engineered mutation (290)
    • Uniprot P09838 (372-399)
    Domains in SCOPe 2.07: d4qzia1, d4qzia2, d4qzia3
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*ap*ap*c)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*tp*tp*tp*tp*gp*gp*g)-3'
  • Chain 'U':
    Compound: 5'-d(*ap*ap*ap*ap*ap*c)-3'
  • Heterogens: ZN, MG, NA, DCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qziA (A:)
    mgsshhhhhhssglvprgshmspspvpgsqnvpapavkkisqyacqrrttlnnynqlftd
    aldilaendelrenegsclafmrassvlkslpfpitsmkdtegipclgdkvksiiegiie
    dgesseakavlnderyksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqk
    agflyyedlvscvnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflits
    peatedeeqqllhkvtdfwkqqglllycdilestfekfkqpsrkvdaldhaqkcflilkl
    dhgrvhseksgqqegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkm
    mldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qziA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdileaqkcf
    lilkldhgrvgkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldn
    halydrtkrvfleaeseeeifahlgldyiepwerna
    

  • Chain 'D':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.