PDB entry 4qyx

View 4qyx on RCSB PDB site
Description: Crystal structure of YDR533Cp
Class: hydrolase
Keywords: alpha-beta sandwich, DJ-1/ThiJ/PfpI superfamily, glyoxalase III, HYDROLASE
Deposited on 2014-07-26, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable chaperone protein HSP31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D9719.36, HSP31, YDR533C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04432
      • engineered mutation (232)
    Domains in SCOPe 2.07: d4qyxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qyxA (A:)
    mapkkvllaltsyndvfysdgaktgvfvvealhpfntfrkegfevdfvsetgkfgwdehs
    lakdflngqdetdfknkdsdfnktlakiktpkevnaddyqiffasaghgtlfdypkakdl
    qdiaseiyanggvvaavchgpaifdgltdkktgrpliegksitgftdvgetilgvdsilk
    aknlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsivalknleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyxA (A:)
    apkkvllaltsyndvfysdgaktgvfvvealhpfntfrkegfevdfvsetgkfgwdehsl
    akdflngqdetdfknkdsdfnktlakiktpkevnaddyqiffasaghgtlfdypkakdlq
    diaseiyanggvvaavchgpaifdgltdkktgrpliegksitgftdvgetilgvdsilka
    knlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsivalk