PDB entry 4qyt

View 4qyt on RCSB PDB site
Description: Schizosaccharomyces pombe DJ-1
Class: unknown function
Keywords: unknown function, cysteine oxidation
Deposited on 2014-07-25, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein C22E12.03c
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC22E12.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyta_
  • Chain 'B':
    Compound: Uncharacterized protein C22E12.03c
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC22E12.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qytb_
  • Chain 'C':
    Compound: Uncharacterized protein C22E12.03c
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC22E12.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qytc_
  • Chain 'D':
    Compound: Uncharacterized protein C22E12.03c
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC22E12.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qytd_
  • Heterogens: EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qytA (A:)
    gshmvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrs
    ykeipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtlta
    ktsglpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvas
    kdkynavykslsmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qytA (A:)
    vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
    psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
    lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
    navykslsmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qytB (B:)
    gshmvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrs
    ykeipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtlta
    ktsglpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvas
    kdkynavykslsmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qytB (B:)
    vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
    psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
    lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
    navykslsmp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qytC (C:)
    gshmvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrs
    ykeipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtlta
    ktsglpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvas
    kdkynavykslsmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qytC (C:)
    vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
    psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
    lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
    navykslsmp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qytD (D:)
    gshmvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrs
    ykeipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtlta
    ktsglpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvas
    kdkynavykslsmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qytD (D:)
    vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
    psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
    lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
    navykslsmp