PDB entry 4qyj

View 4qyj on RCSB PDB site
Description: Structure of Phenylacetaldehyde Dehydrogenase from Pseudomonas putida S12
Class: oxidoreductase
Keywords: Aldehyde Dehydrogenase, OXIDOREDUCTASE
Deposited on 2014-07-24, released 2015-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyja_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyjb_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyjc_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyjd_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyje_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyjf_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyjg_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Pseudomonas putida [TaxId:1215087]
    Gene: RPPX_12610, RPPX_34495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyjh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qyjA (A:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjA (A:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qyjB (B:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjB (B:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qyjC (C:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjC (C:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qyjD (D:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjD (D:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qyjE (E:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjE (E:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qyjF (F:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjF (F:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qyjG (G:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjG (G:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qyjH (H:)
    mgsshhhhhhssglvprgshmnsslsaidglrlphqmliggqwvsaqsgktlnvynpatg
    diltevpdgdvedvnaavesaaatlrsdtwrrmppsarerillrladllevhgdelarle
    tlnngklliysklmevgasaqwlrymagwatkltgstldlslplppevrsrastqrvpvg
    vvaaiipwnfpllmavwkiapalacgntvvlkpaeetpltalrlaelameaglpagalnv
    vtgrgetagdalvrhpkvakvaftgstevgriigsacgrslkavslelggkspvivladc
    dpqeaaegaaaaiffnhgqvctagsrlyvhesiyedviqrlavigesivvgsgleqgvhm
    gpmvskkhhenvlrhirngiedgadlicggteapcaqgffvkptifanrekkdirllsqe
    vfgpvlvatpfsdiaevvneanrsvyglgasiwtndlsaalrindeleagtvwvnthnmv
    dpnlpfggfkdsgvgrehgaaaiehytttrslviay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyjH (H:)
    qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
    sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
    stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
    etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
    acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
    dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
    aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
    dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
    y