PDB entry 4qyh

View 4qyh on RCSB PDB site
Description: CHK1 kinase domain in complex with diazacarbazole GNE-783
Class: transferase/transferase inhibitor
Keywords: protein kinase, phosphotransfer catalyst, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-07-24, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyha_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyhb_
  • Heterogens: 3DX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qyhA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyhA (A:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmknikkeicinkmlnhenvvk
    fyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithr
    dikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
    dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
    psaritipdikkdrwynkplkkga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qyhB (B:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qyhB (B:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmknikkeicinkmlnhenvvk
    fyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithr
    dikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
    dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
    psaritipdikkdrwynkplkkga