PDB entry 4qyg

View 4qyg on RCSB PDB site
Description: CHK1 kinase domain in complex with diazacarbazole compound 14
Class: Transferase/Transferase Inhibitor
Keywords: protein kinase, phosphotransfer catalyst, Transferase-Transferase Inhibitor complex
Deposited on 2014-07-24, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qyga_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qygb_
  • Heterogens: 3DW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qygA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qygA (A:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmknikkeicinkmlnhenvvk
    fyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithr
    dikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
    dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
    psaritipdikkdrwynkplkkga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qygB (B:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qygB (B:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmknikkeicinkmlnhenvvk
    fyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithr
    dikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
    dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
    psaritipdikkdrwynkplkkga