PDB entry 4qxv

View 4qxv on RCSB PDB site
Description: CRYSTAL STRUCTURE of HUMAN TRANSTHYRETIN IN COMPLEX WITH LUTEOLIN AT 1.1 A RESOLUTION
Class: transport protein
Keywords: beta barrel, Wild type TTR, Transthyretin, TRANSPORT PROTEIN
Deposited on 2014-07-22, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR, TTR PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qxva_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR, TTR PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qxvb_
  • Heterogens: LU2, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qxvA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qxvA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qxvB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qxvB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn