PDB entry 4qxa

View 4qxa on RCSB PDB site
Description: Crystal structure of the Rab9A-RUTBC2 RBD complex
Class: protein transport/protein binding
Keywords: PH domain, Rab9A, RUTBC2, Rab binding domain, Rab9-effector complex, PROTEIN TRANSPORT-PROTEIN BINDING complex
Deposited on 2014-07-19, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-9A
    Species: Mus musculus [TaxId:10090]
    Gene: Rab9a, Rab9, Sid99
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R0M6
      • engineered mutation (66)
    Domains in SCOPe 2.08: d4qxaa_
  • Chain 'B':
    Compound: Small G protein signaling modulator 1
    Species: Mus musculus [TaxId:10090]
    Gene: Sgsm1, Rutbc2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qxaA (A:)
    mmagksslfkiillgdggvgksslmnryvtnkfdsqlfhtigveflnkdlevdghfvtmq
    iwdtaglerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpf
    vilgnktdikerqvsteeaqawckdngdypyfetsakdstnvaaafeeavrrilatedrs
    ehliqtdtvnlhrkpkpnsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qxaA (A:)
    slfkiillgdggvgksslmnryvtnkfdsqlfhtigveflnkdlevdghfvtmqiwdtag
    lerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk
    tdikerqvsteeaqawckdngdypyfetsakdstnvaaafeeavrrilated
    

  • Chain 'B':
    No sequence available.