PDB entry 4qx2

View 4qx2 on RCSB PDB site
Description: Cry3A Toxin structure obtained by injecting Bacillus thuringiensis cells in an XFEL beam, collecting data by serial femtosecond crystallographic methods and processing data with the cctbx.xfel software suite
Class: toxin
Keywords: in vivo crystals, microcrystals, serial femtosecond crystallography, SFX, LCLS, X-ray Free-electron laser, insecticidal toxin, TOXIN
Deposited on 2014-07-17, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.17
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pesticidal crystal protein cry3Aa
    Species: Bacillus thuringiensis serovar tenebrionis [TaxId:1444]
    Gene: bt13, cry3A, cry3Aa, cryC, cryIIIa, cryIIIA(a)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qx2a1, d4qx2a2, d4qx2a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qx2A (A:)
    dssttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealm
    dqkiadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshf
    rnsmpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltq
    eytdhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvrlypkevkt
    eltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpgyygndsfn
    ywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnlavwpsavys
    gvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgyshqlnyvm
    cflmqgsrgtipvltwthksvdffnmidskkitqlplvkayklqsgasvvagprftggdi
    iqctengsaatiyvtpdvsysqkyrarihyastsqitftlsldgapfnqyyfdktinkgd
    tltynsfnlasfstpfelsgnnlqigvtglsagdkvyidkiefipvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qx2A (A:)
    ttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealmdqk
    iadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshfrns
    mpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltqeyt
    dhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvrlypkevktelt
    rdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpgyygndsfnyws
    gnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnlavwpsavysgvt
    kvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgyshqlnyvmcfl
    mqgsrgtipvltwthksvdffnmidskkitqlplvkayklqsgasvvagprftggdiiqc
    tengsaatiyvtpdvsysqkyrarihyastsqitftlsldgapfnqyyfdktinkgdtlt
    ynsfnlasfstpfelsgnnlqigvtglsagdkvyidkiefipvn