PDB entry 4qww

View 4qww on RCSB PDB site
Description: Crystal structure of the Fab410-BfAChE complex
Class: hydrolase/immune system
Keywords: a/b hydrolase fold, acetylcholinesterase, monoclonal antibody, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2014-07-17, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Bungarus fasciatus [TaxId:8613]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92035 (Start-534)
    • PDB 4QWW
    Domains in SCOPe 2.07: d4qwwa_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Bungarus fasciatus [TaxId:8613]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92035 (Start-534)
    • PDB 4QWW
    Domains in SCOPe 2.07: d4qwwb_
  • Chain 'C':
    Compound: Fab410 antibody light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QWW (0-End)
    Domains in SCOPe 2.07: d4qwwc1
  • Chain 'D':
    Compound: Fab410 antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QWW (0-End)
  • Chain 'E':
    Compound: Fab410 antibody light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QWW (0-End)
    Domains in SCOPe 2.07: d4qwwe1, d4qwwe2
  • Chain 'F':
    Compound: Fab410 antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QWW (0-End)
  • Heterogens: NAG, MAN, BMA, FUC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qwwA (A:)
    gragelkvstqtgsvrglslpvldghvsaflgipfaepplgrmrflrpepvkpwqhvlda
    tsykpacyqmvdtsypgfqgtemwnpnrgmsedclylniwvpsprpkdapvlvwiygggf
    ysgaasldvydgrfltytqnvilvslsyrvgafgflglpgspeapgnmglldqrlalqwi
    qnnihpfggnpravtvfgesagaasvgmhllstqsrtlfqrailqsggpnapwatvtpae
    srgraallgkqlgchfnndselvsclrsknpqelideewsvlpyksifrfpfvpvidgdf
    fpdtpeamlssgnfketqvllgvvkdegsyfliyglpgfskdneslisradflegvrmsv
    phandiatdavvlqytdwqdqdnreknrealddivgdhnvicpvvqfandyakrnskvya
    ylfdhrasnllwppwmgvphgyeiefvfglplndslnytpqekelsrrmmrywanfartg
    nptdpadksgawptytasqpqyvqlntqplatqpslraqicafwnhflpkllnatvdppr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwwA (A:)
    agelkvstqtgsvrglslpvldghvsaflgipfaepplgrmrflrpepvkpwqhvldats
    ykpacyqmvdtsypgfqgtemwnpnrgmsedclylniwvpsprpkdapvlvwiygggfys
    gaasldvydgrfltytqnvilvslsyrvgafgflglpgspeapgnmglldqrlalqwiqn
    nihpfggnpravtvfgesagaasvgmhllstqsrtlfqrailqsggpnapwatvtpaesr
    graallgkqlgchfnndselvsclrsknpqelideewsvlpyksifrfpfvpvidgdffp
    dtpeamlssgnfketqvllgvvkdegsyfliyglpgfskdneslisradflegvrmsvph
    andiatdavvlqytdwqdqdnreknrealddivgdhnvicpvvqfandyakrnskvyayl
    fdhrasnllwppwmgvphgyeiefvfglplndslnytpqekelsrrmmrywanfartgnp
    tdpaawptytasqpqyvqlntqplatqpslraqicafwnhflpkllnat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qwwB (B:)
    gragelkvstqtgsvrglslpvldghvsaflgipfaepplgrmrflrpepvkpwqhvlda
    tsykpacyqmvdtsypgfqgtemwnpnrgmsedclylniwvpsprpkdapvlvwiygggf
    ysgaasldvydgrfltytqnvilvslsyrvgafgflglpgspeapgnmglldqrlalqwi
    qnnihpfggnpravtvfgesagaasvgmhllstqsrtlfqrailqsggpnapwatvtpae
    srgraallgkqlgchfnndselvsclrsknpqelideewsvlpyksifrfpfvpvidgdf
    fpdtpeamlssgnfketqvllgvvkdegsyfliyglpgfskdneslisradflegvrmsv
    phandiatdavvlqytdwqdqdnreknrealddivgdhnvicpvvqfandyakrnskvya
    ylfdhrasnllwppwmgvphgyeiefvfglplndslnytpqekelsrrmmrywanfartg
    nptdpadksgawptytasqpqyvqlntqplatqpslraqicafwnhflpkllnatvdppr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwwB (B:)
    agelkvstqtgsvrglslpvldghvsaflgipfaepplgrmrflrpepvkpwqhvldats
    ykpacyqmvdtsypgfqgtemwnpnrgmsedclylniwvpsprpkdapvlvwiygggfys
    gaasldvydgrfltytqnvilvslsyrvgafgflglpgspeapgnmglldqrlalqwiqn
    nihpfggnpravtvfgesagaasvgmhllstqsrtlfqrailqsggpnapwatvtpaesr
    graallgkqlgchfnndselvsclrsknpqelideewsvlpyksifrfpfvpvidgdffp
    dtpeamlssgnfketqvllgvvkdegsyfliyglpgfskdneslisradflegvrmsvph
    andiatdavvlqytdwqdqdnreknrealddivgdhnvicpvvqfandyakrnskvyayl
    fdhrasnllwppwmgvphgyeiefvfglplndslnytpqekelsrrmmrywanfartgnp
    tdpaawptytasqpqyvqlntqplatqpslraqicafwnhflpkllnat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qwwC (C:)
    qivltqspaimsaspgekvtmtcsasssvsymywyhqkpgsspkpwiyrtsnlasgvpar
    fsgsgsgtsyslsvssveaedaatyycqqynshpmtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwwC (C:)
    qivltqspaimsaspgekvtmtcsasssvsymywyhqkpgsspkpwiyrtsnlasgvpar
    fsgsgsgtsyslsvssveaedaatyycqqynshpmtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qwwE (E:)
    qivltqspaimsaspgekvtmtcsasssvsymywyhqkpgsspkpwiyrtsnlasgvpar
    fsgsgsgtsyslsvssveaedaatyycqqynshpmtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwwE (E:)
    qivltqspaimsaspgekvtmtcsasssvsymywyhqkpgsspkpwiyrtsnlasgvpar
    fsgsgsgtsyslsvssveaedaatyycqqynshpmtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'F':
    No sequence available.