PDB entry 4qwq

View 4qwq on RCSB PDB site
Description: Crystal structure of the DNA-binding domain of the response regulator SaeR from Staphylococcus aureus
Class: transcription regulator
Keywords: winged helix-turn-helix, gene expression regulation, DNA, TRANSCRIPTION REGULATOR
Deposited on 2014-07-17, released 2015-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator SaeR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: saeR, CH52_02235, X998_0755
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qwqa_
  • Chain 'B':
    Compound: Response regulator SaeR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: saeR, CH52_02235, X998_0755
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qwqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qwqA (A:)
    hhhhhhqpveqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksell
    ekvwgydyyedantvnvhihrireklekesfttytittvwglgykfersr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwqA (A:)
    eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydan
    tvnvhihrireklekesfttytittvwglgykfers
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qwqB (B:)
    hhhhhhqpveqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksell
    ekvwgydyyedantvnvhihrireklekesfttytittvwglgykfersr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwqB (B:)
    eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
    edantvnvhihrireklekesfttytittvwglgykfers