PDB entry 4qwp

View 4qwp on RCSB PDB site
Description: co-crystal structure of chitosanase OU01 with substrate
Class: hydrolase
Keywords: chitosan,glycoside hydrolase, Chitosanase OU01,chito-oligomer, hydrolysis, hydrolase
Deposited on 2014-07-17, released 2015-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Pseudomonas sp. A-01 [TaxId:201382]
    Gene: chitosanase OU01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KZM5 (Start-247)
      • see remark 999 (50)
      • see remark 999 (152)
      • see remark 999 (244)
    Domains in SCOPe 2.05: d4qwpa_
  • Chain 'B':
    Compound: Chitosanase
    Species: Pseudomonas sp. A-01 [TaxId:201382]
    Gene: chitosanase OU01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KZM5 (Start-247)
      • see remark 999 (50)
      • see remark 999 (152)
      • see remark 999 (244)
    Domains in SCOPe 2.05: d4qwpb_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qwpA (A:)
    gplgspefetagtvdldapvqkdtamslvssfensstdwqaqygylediaagrgytggli
    gftsgtgdmlelvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetse
    fraaqdaerdrvyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsa
    alppsqggdeteyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsv
    ygdqysln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwpA (A:)
    gtvdldapvqkdtamslvssfensstdwqaqygylediaagrgytggligftsgtgdmle
    lvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdr
    vyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdet
    eyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qwpB (B:)
    gplgspefetagtvdldapvqkdtamslvssfensstdwqaqygylediaagrgytggli
    gftsgtgdmlelvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetse
    fraaqdaerdrvyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsa
    alppsqggdeteyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsv
    ygdqysln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qwpB (B:)
    gtvdldapvqkdtamslvssfensstdwqaqygylediaagrgytggligftsgtgdmle
    lvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdr
    vyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdet
    eyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln