PDB entry 4quo

View 4quo on RCSB PDB site
Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe(3-CH2NH2)
Class: hydrolase/hydrolase inhibitor
Keywords: M1 family aminopeptidase, metalloprotease, APN, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-07-11, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.15
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Gene: pepN, NMBH4476_0804, NMH_0477
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4quoa1, d4quoa2, d4quoa3, d4quoa4
  • Heterogens: 3DZ, GOL, IMD, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4quoA (A:)
    ktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvki
    ngaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfr
    kitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsyl
    falvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleyd
    ldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgn
    rvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrp
    asyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraama
    danginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvg
    llnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypys
    dddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddl
    ldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakqe
    nqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngne
    sdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkars
    ligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlvk
    qalqriraqeglskdvgeivgkildsna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4quoA (A:)
    ktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvki
    ngaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfr
    kitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsyl
    falvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleyd
    ldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgn
    rvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrp
    asyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraama
    danginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvg
    llnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypys
    dddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddl
    ldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakqe
    nqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngne
    sdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkars
    ligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlvk
    qalqriraqeglskdvgeivgkild