PDB entry 4qth

View 4qth on RCSB PDB site
Description: Crystal structure of anti-uPAR Fab 8B12
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2014-07-08, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-uPAR antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QTH (0-End)
  • Chain 'B':
    Compound: anti-uPAR antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QTH (0-End)
    Domains in SCOPe 2.07: d4qthb1, d4qthb2
  • Chain 'H':
    Compound: anti-uPAR antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QTH (0-223)
  • Chain 'L':
    Compound: anti-uPAR antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QTH (0-213)
    Domains in SCOPe 2.07: d4qthl1, d4qthl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qthB (B:)
    diqmtqspsslsaslgervsltcrasqdigsslnwlqqepdgtikrliyatssldsgvpk
    rfsgsrsgsdysltisrlesedfvdyyclqyatspytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qthB (B:)
    diqmtqspsslsaslgervsltcrasqdigsslnwlqqepdgtikrliyatssldsgvpk
    rfsgsrsgsdysltisrlesedfvdyyclqyatspytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qthL (L:)
    diqmtqspsslsaslgervsltcrasqdigsslnwlqqepdgtikrliyatssldsgvpk
    rfsgsrsgsdysltisrlesedfvdyyclqyatspytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec