PDB entry 4qte

View 4qte on RCSB PDB site
Description: Structure of ERK2 in complex with VTX-11e, 4-{2-[(2-CHLORO-4-FLUOROPHENYL)AMINO]-5-METHYLPYRIMIDIN-4-YL}-N-[(1S)-1-(3-CHLOROPHENYL)-2-HYDROXYETHYL]-1H-PYRROLE-2-CARBOXAMIDE
Class: Transferase/transferase inhibitor
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE, kinase, MAPK, signalling, inhibitor, allosteric, Structural Genomics Consortium (SGC), Transferase-transferase inhibitor complex
Deposited on 2014-07-07, released 2014-07-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERK2, MAPK1, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4qtea_
  • Heterogens: EDO, SO4, CL, 390, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qteA (A:)
    smaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispf
    ehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktq
    hlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhd
    htgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnh
    ilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnph
    krieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyr
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qteA (A:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
    rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
    dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
    pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy