PDB entry 4qqt

View 4qqt on RCSB PDB site
Description: Crystal Structure of FGF Receptor (FGFR) 4 Tyrosine Kinase Domain
Class: transferase
Keywords: Kinase Domain Fold, Cell Signaling, Phosphotransferase, Plasmamembrane, transferase
Deposited on 2014-06-29, released 2014-10-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.223
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR4, JTK2, TKF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22455
      • engineered mutation (233)
    Domains in SCOPe 2.04: d4qqta_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qqtA (A:)
    mgsshhhhhhsqdpllaglvsldlpldplwefprdrlvlgkplgegafgqvvraeafgmd
    parpdqastvavkmlkdnasdkdladlvsemevmkligrhkniinllgvctqegplyviv
    ecaakgnlreflrarrppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcih
    rdlaarnvlvtednvmkiadfglargvhhidyykktsngrlpvkwmapealfdevythqs
    dvwsfgillweiftlggspypgipveelfsllreghrmdrpphcppelyglmrecwhaap
    sqrptfkqlvealdkvllavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqtA (A:)
    lpldplwefprdrlvlgkplgegqvvraeafgmdparpdqastvavkmlkasdkdladlv
    semevmkligrhkniinllgvctqegplyvivecaakgnlreflrarrpprssegplsfp
    vlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfglargvhhidyykkts
    ngrlpvkwmapealfdevythqsdvwsfgillweiftlggspypgipveelfsllreghr
    mdrpphcppelyglmrecwhaapsqrptfkqlvealdkvllav