PDB entry 4qqc

View 4qqc on RCSB PDB site
Description: Crystal Structure of FGF Receptor (FGFR) 4 Kinase Domain in Complex with FIIN-2, an Irreversible Tyrosine Kinase Inhibitor Capable of Overcoming FGFR Kinase Gate-Keeper Mutations
Class: Transferase/transferase inhibitor
Keywords: Kinase Domain Fold, Cell Signaling, Phosphotransferase, Plasmamembrane, Transferase-transferase inhibitor complex
Deposited on 2014-06-27, released 2014-10-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.163
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR4, JTK2, TKF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22455 (14-End)
      • expression tag (12-13)
      • engineered mutation (233)
    Domains in SCOPe 2.04: d4qqca_
  • Heterogens: 37O, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qqcA (A:)
    mgsshhhhhhsqdpllaglvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmd
    parpdqastvavkmlkdnasdkdladlvsemevmkligrhkniinllgvctqegplyviv
    ecaakgnlreflrarrppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcih
    rdlaarnvlvtednvmkiadfglargvhhidyykktsngrlpvkwmapealfdevythqs
    dvwsfgillweiftlggspypgipveelfsllreghrmdrpphcppelyglmrecwhaap
    sqrptfkqlvealdkvllavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqcA (A:)
    dpllaglvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdqastvavkmlkd
    nasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarrp
    pgplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfgllpvkwma
    pealfdevythqsdvwsfgillweiftlggspypgipveelfsllreghrmdrpphcppe
    lyglmrecwhaapsqrptfkqlvealdkvllav