PDB entry 4qq6

View 4qq6 on RCSB PDB site
Description: Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule
Class: RNA binding protein
Keywords: structural genomics, Structural Genomics Consortium, SGC, RNA BINDING PROTEIN
Deposited on 2014-06-26, released 2014-08-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Survival motor neuron protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SMN1, SMN, SMNT, SMN2, SMNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4qq6a_
  • Heterogens: UNX, 36X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qq6A (A:)
    gkkntaaslqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsd
    llspice
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qq6A (A:)
    qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspice